ACCN1 Antikörper

Produktnummer ABIN633674

Der Kaninchen Polyklonal Anti-ACCN1-Antikörper wurde für WB validiert. Er ist geeignet, ACCN1 in Proben von Human und Hund zu detektieren.

Kurzübersicht für ACCN1 Antikörper (ABIN633674)

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACCN1 Antikörper

Aufreinigung: Affinity purified

Immunogen: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACCN1 Blocking Peptide, (ABIN938583), is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Andere Bezeichnung: ACCN1

Hintergrund: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Sensory Perception of Sound