ACCN1 Antikörper
-
- Target Alle ACCN1 Antikörper anzeigen
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACCN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA
- Top Product
- Discover our top product ACCN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACCN1 Blocking Peptide, catalog no. 33R-5124, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Andere Bezeichnung
- ACCN1 (ACCN1 Produkte)
- Synonyme
- ACCN antikoerper, ACCN1 antikoerper, ASIC2a antikoerper, BNC1 antikoerper, BNaC1 antikoerper, MDEG antikoerper, hBNaC1 antikoerper, ACIC2 antikoerper, Accn1 antikoerper, BNaC1a antikoerper, Mdeg antikoerper, BNC1k antikoerper, MDEG1 antikoerper, MDEG2 antikoerper, accn1 antikoerper, zASIC2 antikoerper, acid sensing ion channel subunit 2 antikoerper, acid-sensing (proton-gated) ion channel 2 antikoerper, ASIC2 antikoerper, Asic2 antikoerper, asic2 antikoerper
- Hintergrund
- ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-