KCNIP2 Antikörper (N-Term)
-
- Target Alle KCNIP2 Antikörper anzeigen
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNIP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- KCNIP2 antibody was raised against the N terminal of KCNIP2
- Aufreinigung
- Affinity purified
- Immunogen
- KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS
- Top Product
- Discover our top product KCNIP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.06 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNIP2 Blocking Peptide, catalog no. 33R-7647, is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
- Andere Bezeichnung
- KCNIP2 (KCNIP2 Produkte)
- Synonyme
- KCHIP2 antikoerper, KCNIP2 antikoerper, Kchip2 antikoerper, KChIP2 antikoerper, kchip2 antikoerper, si:ch73-173h19.2 antikoerper, potassium voltage-gated channel interacting protein 2 antikoerper, Kv channel-interacting protein 2 antikoerper, Kv channel interacting protein 2 S homeolog antikoerper, Kv channel interacting protein 2 antikoerper, KCNIP2 antikoerper, Kcnip2 antikoerper, kcnip2.S antikoerper, kcnip2 antikoerper
- Hintergrund
- KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.
- Molekulargewicht
- 21 kDa (MW of target protein)
-