KCNIP2 Antikörper (N-Term)

Produktnummer ABIN633671

Der Kaninchen Polyklonal Anti-KCNIP2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, KCNIP2 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für KCNIP2 Antikörper (N-Term) (ABIN633671)

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-KCNIP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: KCNIP2 antibody was raised against the N terminal of KCNIP2

Aufreinigung: Affinity purified

Immunogen: KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS

Anwendungsinformationen

Applikationshinweise: WB: 0.06 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNIP2 Blocking Peptide, (ABIN5614279), is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNIP2

Target: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Andere Bezeichnung: KCNIP2

Hintergrund: KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

Molekulargewicht: 21 kDa (MW of target protein)