KCTD7 Antikörper (N-Term)

Produktnummer ABIN633658

Produktdetails anti-KCTD7 Antikörper

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD7 antibody was raised against the N terminal of KCTD7

Aufreinigung: Affinity purified

Immunogen: KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD7 Blocking Peptide, catalog no. 33R-9904, is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD7

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Andere Bezeichnung: KCTD7 (KCTD7 Produkte)

Synonyme: 4932409E18 antikoerper, 9430010P06Rik antikoerper, zgc:136884 antikoerper, CLN14 antikoerper, EPM3 antikoerper, potassium channel tetramerization domain containing 7 antikoerper, potassium channel tetramerisation domain containing 7 antikoerper, KCTD7 antikoerper, Kctd7 antikoerper, kctd7 antikoerper

Hintergrund: The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.

Molekulargewicht: 33 kDa (MW of target protein)