BTBD10 Antikörper

Produktnummer ABIN633657

Dieser Anti-BTBD10-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von BTBD10 in WB. Geeignet für Human.

Kurzübersicht für BTBD10 Antikörper (ABIN633657)

Target: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTBD10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BTBD10 Antikörper

Aufreinigung: Affinity purified

Immunogen: BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTBD10 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BTBD10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTBD10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTBD10

Target: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Andere Bezeichnung: BTBD10

Hintergrund: BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

Molekulargewicht: 54 kDa (MW of target protein)