BTBD10 Antikörper
-
- Target Alle BTBD10 Produkte
- BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BTBD10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BTBD10 Blocking Peptide, catalog no. 33R-1218, is also available for use as a blocking control in assays to test for specificity of this BTBD10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTBD10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))
- Andere Bezeichnung
- BTBD10 (BTBD10 Produkte)
- Hintergrund
- BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.
- Molekulargewicht
- 54 kDa (MW of target protein)
-