SHROOM2 Antikörper (Middle Region)

Produktnummer ABIN633652

Produktdetails anti-SHROOM2 Antikörper

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHROOM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SHROOM2 antibody was raised against the middle region of SHROOM2

Aufreinigung: Affinity purified

Immunogen: SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHROOM2

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Andere Bezeichnung: SHROOM2 (SHROOM2 Produkte)

Synonyme: SHROOM2 antikoerper, APXL antikoerper, apxl antikoerper, shrm2 antikoerper, HSAPXL antikoerper, 4832440C16 antikoerper, Apxl antikoerper, C630003H05Rik antikoerper, Shrm2 antikoerper, shroom family member 2 antikoerper, SHROOM2 antikoerper, shroom2 antikoerper, Shroom2 antikoerper

Hintergrund: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Molekulargewicht: 176 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Asymmetric Protein Localization