SHROOM2 Antikörper (Middle Region)

Produktnummer ABIN633652

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SHROOM2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SHROOM2 Antikörper (Middle Region) (ABIN633652)

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHROOM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SHROOM2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SHROOM2 antibody was raised against the middle region of SHROOM2

Aufreinigung: Affinity purified

Immunogen: SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHROOM2 Blocking Peptide, (ABIN937210), is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHROOM2

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Andere Bezeichnung: SHROOM2

Hintergrund: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Molekulargewicht: 176 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Asymmetric Protein Localization