CCT8L2 Antikörper
-
- Target Alle CCT8L2 Antikörper anzeigen
- CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCT8L2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CCT8 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR
- Top Product
- Discover our top product CCT8L2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCT8L2 Blocking Peptide, catalog no. 33R-1202, is also available for use as a blocking control in assays to test for specificity of this CCT8L2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCT8L2 (Chaperonin Containing TCP1, Subunit 8 (Theta)-Like 2 (CCT8L2))
- Andere Bezeichnung
- CCT8L2 (CCT8L2 Produkte)
- Synonyme
- CESK1 antikoerper, chaperonin containing TCP1 subunit 8 like 2 antikoerper, CCT8L2 antikoerper
- Hintergrund
- CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.
- Molekulargewicht
- 59 kDa (MW of target protein)
-