KCTD19 Antikörper (N-Term)
-
- Target Alle KCTD19 Produkte
- KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD19 antibody was raised against the n terminal of KCTD19
- Aufreinigung
- Affinity purified
- Immunogen
- KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD19 Blocking Peptide, catalog no. 33R-2168, is also available for use as a blocking control in assays to test for specificity of this KCTD19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))
- Andere Bezeichnung
- KCTD19 (KCTD19 Produkte)
- Hintergrund
- The function of KCTD19 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 102 kDa (MW of target protein)
-