CLIC6 Antikörper (Middle Region)

Produktnummer ABIN633620

Produktdetails anti-CLIC6 Antikörper

Target: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLIC6 antibody was raised against the middle region of CLIC6

Aufreinigung: Affinity purified

Immunogen: CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC6 Blocking Peptide, catalog no. 33R-8134, is also available for use as a blocking control in assays to test for specificity of this CLIC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC6

Target: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Andere Bezeichnung: CLIC6 (CLIC6 Produkte)

Synonyme: CLIC6 antikoerper, CLIC1L antikoerper, 5730466J16Rik antikoerper, AL022908 antikoerper, AW045520 antikoerper, Clic6b antikoerper, chloride intracellular channel 6 antikoerper, CLIC6 antikoerper, Clic6 antikoerper

Hintergrund: CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.

Molekulargewicht: 75 kDa (MW of target protein)