TIA1 Antikörper (N-Term)
-
- Target Alle TIA1 Antikörper anzeigen
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TIA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TIA1 antibody was raised against the N terminal of TIA1
- Aufreinigung
- Affinity purified
- Immunogen
- TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
- Top Product
- Discover our top product TIA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TIA1 Blocking Peptide, catalog no. 33R-6040, is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
- Andere Bezeichnung
- TIA1 (TIA1 Produkte)
- Synonyme
- tia1 antikoerper, 2310050N03Rik antikoerper, AI256674 antikoerper, TIA-1 antikoerper, mTIA-1 antikoerper, WDM antikoerper, TIAL1 antikoerper, TIAR antikoerper, tia-1 antikoerper, nucleolysin TIA-1 isoform p40 antikoerper, hypothetical protein antikoerper, nucleolysin TIAR antikoerper, nucleolysin tia-1 antikoerper, nucleolysin TIA-1 antikoerper, cytotoxic granule-associated RNA binding protein 1 antikoerper, TIA1 cytotoxic granule associated RNA binding protein antikoerper, TIA1 cytotoxic granule-associated RNA binding protein antikoerper, TIA1 cytotoxic granule-associated RNA binding protein L homeolog antikoerper, PTRG_10065 antikoerper, PGTG_08590 antikoerper, LOC5568274 antikoerper, CpipJ_CPIJ013665 antikoerper, VDBG_07004 antikoerper, MGYG_03339 antikoerper, Tsp_15456 antikoerper, tia1 antikoerper, Tia1 antikoerper, TIA1 antikoerper, tia1.L antikoerper
- Hintergrund
- TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.
- Molekulargewicht
- 43 kDa (MW of target protein)
-