TIA1 Antikörper (N-Term)

Produktnummer ABIN633608

Der Kaninchen Polyklonal anti-TIA1 Antikörper wird verwendet zum Nachweis von TIA1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für TIA1 Antikörper (N-Term) (ABIN633608)

Target: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TIA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TIA1 antibody was raised against the N terminal of TIA1

Aufreinigung: Affinity purified

Immunogen: TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIA1 Blocking Peptide, (ABIN5616598), is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIA1

Target: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Andere Bezeichnung: TIA1

Hintergrund: TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.

Molekulargewicht: 43 kDa (MW of target protein)