RBM12 Antikörper (N-Term)

Produktnummer ABIN633604

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RBM12 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für RBM12 Antikörper (N-Term) (ABIN633604)

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM12 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBM12 antibody was raised against the N terminal of RBM12

Aufreinigung: Affinity purified

Immunogen: RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM12 Blocking Peptide, catalog no. 33R-7271, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM12

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Andere Bezeichnung: RBM12

Hintergrund: RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

Molekulargewicht: 97 kDa (MW of target protein)