RBM12 Antikörper (Middle Region)

Produktnummer ABIN633603

Dieses Anti-RBM12-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RBM12 in WB. Geeignet für Human.

Kurzübersicht für RBM12 Antikörper (Middle Region) (ABIN633603)

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBM12 antibody was raised against the middle region of RBM12

Aufreinigung: Affinity purified

Immunogen: RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM12 Blocking Peptide, (ABIN5615780), is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM12

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Andere Bezeichnung: RBM12

Hintergrund: RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

Molekulargewicht: 97 kDa (MW of target protein)