RNASET2 Antikörper (Middle Region)

Produktnummer ABIN633593

Produktdetails anti-RNASET2 Antikörper

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNASET2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNASET2 antibody was raised against the middle region of RNASET2

Aufreinigung: Affinity purified

Immunogen: RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNASET2

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Andere Bezeichnung: RNASET2 (RNASET2 Produkte)

Synonyme: RNASE6PL antikoerper, bA514O12.3 antikoerper, MGC83874 antikoerper, MGC145364 antikoerper, dre2 antikoerper, wu:fc10c06 antikoerper, zgc:113369 antikoerper, ribonuclease T2 antikoerper, ribonuclease T2 L homeolog antikoerper, ribonuclease t2 antikoerper, RNASET2 antikoerper, Rnaset2 antikoerper, rnaset2.L antikoerper, rnaset2 antikoerper, TM1040_2631 antikoerper, RPE_1409 antikoerper, Bind_1696 antikoerper, Dd586_2225 antikoerper, Nhal_0810 antikoerper, Snov_2442 antikoerper, Fbal_2689 antikoerper, Nitsa_0808 antikoerper, Mesop_3495 antikoerper

Hintergrund: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.

Molekulargewicht: 29 kDa (MW of target protein)