RNASET2 Antikörper (Middle Region)
-
- Target Alle RNASET2 Antikörper anzeigen
- RNASET2 (Ribonuclease T2 (RNASET2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNASET2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNASET2 antibody was raised against the middle region of RNASET2
- Aufreinigung
- Affinity purified
- Immunogen
- RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
- Top Product
- Discover our top product RNASET2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASET2 (Ribonuclease T2 (RNASET2))
- Andere Bezeichnung
- RNASET2 (RNASET2 Produkte)
- Synonyme
- RNASE6PL antikoerper, bA514O12.3 antikoerper, MGC83874 antikoerper, MGC145364 antikoerper, dre2 antikoerper, wu:fc10c06 antikoerper, zgc:113369 antikoerper, ribonuclease T2 antikoerper, ribonuclease T2 L homeolog antikoerper, ribonuclease t2 antikoerper, RNASET2 antikoerper, Rnaset2 antikoerper, rnaset2.L antikoerper, rnaset2 antikoerper, TM1040_2631 antikoerper, RPE_1409 antikoerper, Bind_1696 antikoerper, Dd586_2225 antikoerper, Nhal_0810 antikoerper, Snov_2442 antikoerper, Fbal_2689 antikoerper, Nitsa_0808 antikoerper, Mesop_3495 antikoerper
- Hintergrund
- This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
- Molekulargewicht
- 29 kDa (MW of target protein)
-