RNASET2 Antikörper (Middle Region)

Produktnummer ABIN633593

Der Kaninchen Polyklonal Anti-RNASET2-Antikörper wurde für WB validiert. Er ist geeignet, RNASET2 in Proben von Human zu detektieren.

Kurzübersicht für RNASET2 Antikörper (Middle Region) (ABIN633593)

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNASET2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RNASET2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RNASET2 antibody was raised against the middle region of RNASET2

Aufreinigung: Affinity purified

Immunogen: RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNASET2

Target: RNASET2 (Ribonuclease T2 (RNASET2))

Andere Bezeichnung: RNASET2

Hintergrund: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.

Molekulargewicht: 29 kDa (MW of target protein)