EWSR1 Antikörper (N-Term)
-
- Target Alle EWSR1 Antikörper anzeigen
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EWSR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EWSR1 antibody was raised against the N terminal of EWSR1
- Aufreinigung
- Affinity purified
- Immunogen
- EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
- Top Product
- Discover our top product EWSR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Andere Bezeichnung
- EWSR1 (EWSR1 Produkte)
- Synonyme
- EWS antikoerper, bK984G1.4 antikoerper, AU018891 antikoerper, Ews antikoerper, Ewsh antikoerper, EWSR1 antikoerper, fc04c01 antikoerper, wu:fc04c01 antikoerper, DKFZp459K1116 antikoerper, ewsr1 antikoerper, ewsr1.S antikoerper, fb40b11 antikoerper, fusl antikoerper, wu:fb40b11 antikoerper, wu:fb75g09 antikoerper, zgc:55864 antikoerper, EWS RNA binding protein 1 antikoerper, Ewing sarcoma breakpoint region 1 antikoerper, EWS RNA-binding protein 1 antikoerper, EWS RNA-binding protein 1a antikoerper, EWS RNA binding protein 1 L homeolog antikoerper, EWS RNA-binding protein 1b antikoerper, EWSR1 antikoerper, Ewsr1 antikoerper, ewsr1a antikoerper, ewsr1 antikoerper, ewsr1.L antikoerper, ewsr1b antikoerper
- Hintergrund
- EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.
- Molekulargewicht
- 52 kDa (MW of target protein)
-