EWSR1 Antikörper (N-Term)

Produktnummer ABIN633586

Produktdetails anti-EWSR1 Antikörper

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EWSR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EWSR1 antibody was raised against the N terminal of EWSR1

Aufreinigung: Affinity purified

Immunogen: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Andere Bezeichnung: EWSR1 (EWSR1 Produkte)

Synonyme: EWS antikoerper, bK984G1.4 antikoerper, AU018891 antikoerper, Ews antikoerper, Ewsh antikoerper, EWSR1 antikoerper, fc04c01 antikoerper, wu:fc04c01 antikoerper, DKFZp459K1116 antikoerper, ewsr1 antikoerper, ewsr1.S antikoerper, fb40b11 antikoerper, fusl antikoerper, wu:fb40b11 antikoerper, wu:fb75g09 antikoerper, zgc:55864 antikoerper, EWS RNA binding protein 1 antikoerper, Ewing sarcoma breakpoint region 1 antikoerper, EWS RNA-binding protein 1 antikoerper, EWS RNA-binding protein 1a antikoerper, EWS RNA binding protein 1 L homeolog antikoerper, EWS RNA-binding protein 1b antikoerper, EWSR1 antikoerper, Ewsr1 antikoerper, ewsr1a antikoerper, ewsr1 antikoerper, ewsr1.L antikoerper, ewsr1b antikoerper

Hintergrund: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Molekulargewicht: 52 kDa (MW of target protein)