EWSR1 Antikörper (N-Term)

Produktnummer ABIN633586

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EWSR1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für EWSR1 Antikörper (N-Term) (ABIN633586)

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EWSR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EWSR1 Antikörper

Bindungsspezifität: N-Term

Spezifität: EWSR1 antibody was raised against the N terminal of EWSR1

Aufreinigung: Affinity purified

Immunogen: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EWSR1 Blocking Peptide, (ABIN5613422), is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Andere Bezeichnung: EWSR1

Hintergrund: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Molekulargewicht: 52 kDa (MW of target protein)