RPL18 Antikörper (N-Term)

Produktnummer ABIN633580

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPL18 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RPL18 Antikörper (N-Term) (ABIN633580)

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL18 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPL18 antibody was raised against the N terminal of RPL18

Aufreinigung: Affinity purified

Immunogen: RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL18 Blocking Peptide, (ABIN5615936), is also available for use as a blocking control in assays to test for specificity of this RPL18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL18

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Andere Bezeichnung: RPL18

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 22 kDa (MW of target protein)