NSUN6 Antikörper (N-Term)
Kurzübersicht für NSUN6 Antikörper (N-Term) (ABIN633557)
Target
Alle NSUN6 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- NSUN6 antibody was raised against the N terminal of NSUN6
-
Aufreinigung
- Affinity purified
-
Immunogen
- NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
-
-
-
-
Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
NSUN6 Blocking Peptide, (ABIN5615072), is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
-
Andere Bezeichnung
- NSUN6
-
Hintergrund
- NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.
-
Molekulargewicht
- 52 kDa (MW of target protein)
Target
-