FAM71D Antikörper (Middle Region)

Produktnummer ABIN633553

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch FAM71D in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FAM71D Antikörper (Middle Region) (ABIN633553)

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM71D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM71D Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM71 D antibody was raised against the middle region of FAM71

Aufreinigung: Affinity purified

Immunogen: FAM71 D antibody was raised using the middle region of FAM71 corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM71D Blocking Peptide, (ABIN5613499), is also available for use as a blocking control in assays to test for specificity of this FAM71D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM71D

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Andere Bezeichnung: FAM71D

Hintergrund: The function of FAM71 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)