MGC27016 (N-Term) Antikörper

Produktnummer ABIN633549

Dieses Anti--Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von in IHC und WB. Geeignet für Hund, Human, Maus und Ratte.

Kurzübersicht für MGC27016 (N-Term) Antikörper (ABIN633549)

Target: MGC27016

Reaktivität: Hund, Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: MGC27016 antibody was raised against the N terminal of MGC27016

Aufreinigung: Affinity purified

Immunogen: MGC27016 antibody was raised using the N terminal of MGC27016 corresponding to a region with amino acids LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGC27016 Blocking Peptide, (ABIN5614744), is also available for use as a blocking control in assays to test for specificity of this MGC27016 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC27016 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: MGC27016

Hintergrund: MGC27016 is involved in pseudouridine synthase activity and RNA binding.

Molekulargewicht: 59 kDa (MW of target protein)