HEXIM2 Antikörper (N-Term)

Produktnummer ABIN633546

Produktdetails anti-HEXIM2 Antikörper

Target: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEXIM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HEXIM2 antibody was raised against the N terminal of HEXIM2

Aufreinigung: Affinity purified

Immunogen: HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXIM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEXIM2

Target: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Andere Bezeichnung: HEXIM2 (HEXIM2 Produkte)

Synonyme: 4933402L21Rik antikoerper, hexamethylene bisacetamide inducible 2 antikoerper, hexamethylene bis-acetamide inducible 2 antikoerper, HEXIM2 antikoerper, Hexim2 antikoerper

Hintergrund: HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Molekulargewicht: 31 kDa (MW of target protein)