LARP4 Antikörper (Middle Region)

Produktnummer ABIN633545

Produktdetails anti-LARP4 Antikörper

Target: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LARP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LARP4 antibody was raised against the middle region of LARP4

Aufreinigung: Affinity purified

Immunogen: LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LARP4 Blocking Peptide, catalog no. 33R-9818, is also available for use as a blocking control in assays to test for specificity of this LARP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LARP4

Target: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Andere Bezeichnung: LARP4 (LARP4 Produkte)

Synonyme: C530046N12 antikoerper, D330037H05Rik antikoerper, DXErtd793 antikoerper, DXErtd793e antikoerper, La ribonucleoprotein domain family member 4 antikoerper, La ribonucleoprotein domain family, member 4 antikoerper, LARP4 antikoerper, larp4 antikoerper, Larp4 antikoerper

Hintergrund: The function of LARP4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 72 kDa (MW of target protein)