LARP4 Antikörper (Middle Region)

Produktnummer ABIN633545

Der Kaninchen Polyklonal anti-LARP4 Antikörper wird verwendet zum Nachweis von LARP4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für LARP4 Antikörper (Middle Region) (ABIN633545)

Target: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LARP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LARP4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LARP4 antibody was raised against the middle region of LARP4

Aufreinigung: Affinity purified

Immunogen: LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LARP4 Blocking Peptide, (ABIN5614416), is also available for use as a blocking control in assays to test for specificity of this LARP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LARP4

Target: LARP4 (La Ribonucleoprotein Domain Family, Member 4 (LARP4))

Andere Bezeichnung: LARP4

Hintergrund: The function of LARP4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 72 kDa (MW of target protein)