RPF1 Antikörper (N-Term)

Produktnummer ABIN633541

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPF1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RPF1 Antikörper (N-Term) (ABIN633541)

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: BXDC5 antibody was raised against the N terminal of BXDC5

Aufreinigung: Affinity purified

Immunogen: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BXDC5 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPF1

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Andere Bezeichnung: BXDC5

Hintergrund: BXDC5 may be required for ribosome biogenesis.

Molekulargewicht: 38 kDa (MW of target protein)