ESRP2 Antikörper (N-Term)
-
- Target Alle ESRP2 Antikörper anzeigen
- ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ESRP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM35 B antibody was raised against the N terminal of RBM35
- Aufreinigung
- Affinity purified
- Immunogen
- RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ
- Top Product
- Discover our top product ESRP2 Primärantikörper
-
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (AA 615-720) antibody
ESRP2 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) antibodyESRP2 Reaktivität: Human, Maus, Ratte ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) antibodyESRP2 Reaktivität: Maus WB Wirt: Maus Monoclonal 22C5-H7-A6 unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (AA 600-649) antibodyESRP2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Meerschweinchen, Affe, Pferd, Fledermaus, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (AA 1-717) antibodyESRP2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (N-Term) antibodyESRP2 Reaktivität: Human, Maus WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (AA 61-110) antibodyESRP2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Epithelial Splicing Regulatory Protein 2 (ESRP2) (AA 36-85) antibodyESRP2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM35B Blocking Peptide, catalog no. 33R-1548, is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))
- Andere Bezeichnung
- RBM35B (ESRP2 Produkte)
- Synonyme
- RBM35B antikoerper, 9530027K23Rik antikoerper, Rbm35b antikoerper, RGD1310855 antikoerper, cb404 antikoerper, fa07a06 antikoerper, rbm35b antikoerper, sb:cb404 antikoerper, zgc:77254 antikoerper, epithelial splicing regulatory protein 2 antikoerper, microRNA 6773 antikoerper, ESRP2 antikoerper, Esrp2 antikoerper, MIR6773 antikoerper, esrp2 antikoerper
- Hintergrund
- RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.
- Molekulargewicht
- 77 kDa (MW of target protein)
-
