ESRP2 Antikörper (N-Term)

Produktnummer ABIN633540

Dieses Anti-ESRP2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ESRP2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ESRP2 Antikörper (N-Term) (ABIN633540)

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ESRP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ESRP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBM35 B antibody was raised against the N terminal of RBM35

Aufreinigung: Affinity purified

Immunogen: RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM35B Blocking Peptide, (ABIN936934), is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ESRP2

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Andere Bezeichnung: RBM35B

Hintergrund: RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

Molekulargewicht: 77 kDa (MW of target protein)