MTHFSD Antikörper (N-Term)

Produktnummer ABIN633537

Der Kaninchen Polyklonal anti-MTHFSD Antikörper (ABIN633537) detektiert spezifisch MTHFSD in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MTHFSD Antikörper (N-Term) (ABIN633537)

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTHFSD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MTHFSD Antikörper

Bindungsspezifität: N-Term

Spezifität: MTHFSD antibody was raised against the N terminal of MTHFSD

Aufreinigung: Affinity purified

Immunogen: MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTHFSD Blocking Peptide, (ABIN5614871), is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTHFSD

Target: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))

Andere Bezeichnung: MTHFSD

Hintergrund: The function remains unknows.

Molekulargewicht: 42 kDa (MW of target protein)