PAPOLB Antikörper (N-Term)

Produktnummer ABIN633532

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PAPOLB in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PAPOLB Antikörper (N-Term) (ABIN633532)

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAPOLB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAPOLB Antikörper

Bindungsspezifität: N-Term

Spezifität: PAPOLB antibody was raised against the N terminal of PAPOLB

Aufreinigung: Affinity purified

Immunogen: PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAPOLB Blocking Peptide, (ABIN5615210), is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPOLB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAPOLB

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Andere Bezeichnung: PAPOLB

Hintergrund: PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

Molekulargewicht: 72 kDa (MW of target protein)