RBM47 Antikörper (Middle Region)

Produktnummer ABIN633531

Dieses Anti-RBM47-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RBM47 in WB. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für RBM47 Antikörper (Middle Region) (ABIN633531)

Target: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM47 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBM47 antibody was raised against the middle region of RBM47

Aufreinigung: Affinity purified

Immunogen: RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM47 Blocking Peptide, (ABIN939116), is also available for use as a blocking control in assays to test for specificity of this RBM47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM47

Target: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Andere Bezeichnung: RBM47

Hintergrund: RBM47 may be involved in RNA binding and nucleotide binding.

Molekulargewicht: 57 kDa (MW of target protein)