ADARB2 Antikörper

Produktnummer ABIN633530

Produktdetails anti-ADARB2 Antikörper

Target: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADARB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADARB2

Target: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Andere Bezeichnung: ADARB2 (ADARB2 Produkte)

Synonyme: Adar3 antikoerper, RED2 antikoerper, Red2 antikoerper, ADAR3 antikoerper, si:dkey-255g15.1 antikoerper, double-stranded RNA-specific editase B2 antikoerper, adenosine deaminase, RNA specific B2 (inactive) antikoerper, adenosine deaminase, RNA-specific, B2 antikoerper, adenosine deaminase, RNA-specific, B2 (non-functional) antikoerper, LOC722075 antikoerper, LOC742985 antikoerper, ADARB2 antikoerper, Adarb2 antikoerper, adarb2 antikoerper

Hintergrund: ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.

Molekulargewicht: 80 kDa (MW of target protein)