ADARB2 Antikörper
-
- Target Alle ADARB2 Antikörper anzeigen
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADARB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
- Top Product
- Discover our top product ADARB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
- Andere Bezeichnung
- ADARB2 (ADARB2 Produkte)
- Hintergrund
- ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.
- Molekulargewicht
- 80 kDa (MW of target protein)
-