SRBD1 Antikörper (N-Term)

Produktnummer ABIN633529

Produktdetails anti-SRBD1 Antikörper

Target: SRBD1 (S1 RNA Binding Domain 1 (SRBD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRBD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRBD1 antibody was raised against the N terminal of SRBD1

Aufreinigung: Affinity purified

Immunogen: SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRBD1 Blocking Peptide, catalog no. 33R-6501, is also available for use as a blocking control in assays to test for specificity of this SRBD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRBD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRBD1

Target: SRBD1 (S1 RNA Binding Domain 1 (SRBD1))

Andere Bezeichnung: SRBD1 (SRBD1 Produkte)

Synonyme: AI461933 antikoerper, C85414 antikoerper, D530025C17Rik antikoerper, S1 RNA binding domain 1 antikoerper, SRBD1 antikoerper, Srbd1 antikoerper

Hintergrund: SRBD1 contains 1 S1 motif domain. The exact function of SRBD1 remains unknown.

Molekulargewicht: 112 kDa (MW of target protein)