CTA-126B4.3 (N-Term) Antikörper

Produktnummer ABIN633524

Der Kaninchen Polyklonal anti-CTA-126B4.3 Antikörper wird verwendet zum Nachweis von CTA-126B4.3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CTA-126B4.3 (N-Term) Antikörper (ABIN633524)

Target: CTA-126B4.3

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: CTA-126 B4.3 antibody was raised against the N terminal of CTA-126 4.3

Aufreinigung: Affinity purified

Immunogen: CTA-126 B4.3 antibody was raised using the N terminal of CTA-126 4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CTA-126B4.3 Blocking Peptide, (ABIN5613023), is also available for use as a blocking control in assays to test for specificity of this CTA-126B4.3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTA-120 4.3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: CTA-126B4.3

Hintergrund: The function of CTA-126B4.3 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 32 kDa (MW of target protein)