RBM34 Antikörper (C-Term)

Produktnummer ABIN633521

Der Kaninchen Polyklonal anti-RBM34 Antikörper wird verwendet zum Nachweis von RBM34 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für RBM34 Antikörper (C-Term) (ABIN633521)

Target: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM34 Antikörper

Bindungsspezifität: C-Term

Spezifität: RBM34 antibody was raised against the C terminal of RBM34

Aufreinigung: Affinity purified

Immunogen: RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM34 Blocking Peptide, (ABIN5615787), is also available for use as a blocking control in assays to test for specificity of this RBM34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM34

Target: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Andere Bezeichnung: RBM34

Hintergrund: RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.

Molekulargewicht: 48 kDa (MW of target protein)