NSF Antikörper (C-Term)

Produktnummer ABIN633516

Dieses Anti-NSF-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NSF in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für NSF Antikörper (C-Term) (ABIN633516)

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NSF Antikörper

Bindungsspezifität: C-Term

Spezifität: NSF antibody was raised against the C terminal of NSF

Aufreinigung: Affinity purified

Immunogen: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSF Blocking Peptide, (ABIN5615065), is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSF

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Andere Bezeichnung: NSF

Hintergrund: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Molekulargewicht: 33 kDa (MW of target protein)