RBM42 Antikörper (Middle Region)

Produktnummer ABIN633507

Dieser Anti-RBM42-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von RBM42 in WB. Geeignet für Human.

Kurzübersicht für RBM42 Antikörper (Middle Region) (ABIN633507)

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM42 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBM42 antibody was raised against the middle region of RBM42

Aufreinigung: Affinity purified

Immunogen: RBM42 antibody was raised using the middle region of RBM42 corresponding to a region with amino acids RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM42 Blocking Peptide, (ABIN5615794), is also available for use as a blocking control in assays to test for specificity of this RBM42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM42

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Andere Bezeichnung: RBM42

Hintergrund: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.

Molekulargewicht: 50 kDa (MW of target protein)