CELF5 Antikörper (Middle Region)
-
- Target Alle CELF5 Antikörper anzeigen
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CELF5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BRUNOL5 antibody was raised against the middle region of BRUNOL5
- Aufreinigung
- Affinity purified
- Immunogen
- BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP
- Top Product
- Discover our top product CELF5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BRUNOL5 Blocking Peptide, catalog no. 33R-1175, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
- Andere Bezeichnung
- BRUNOL5 (CELF5 Produkte)
- Synonyme
- BRUNOL-5 antikoerper, BRUNOL5 antikoerper, CELF-5 antikoerper, 4930565A21Rik antikoerper, Brunol5 antikoerper, RGD1565016 antikoerper, CUGBP Elav-like family member 5 antikoerper, CUGBP, Elav-like family member 5 antikoerper, CELF5 antikoerper, Celf5 antikoerper
- Hintergrund
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.
- Molekulargewicht
- 52 kDa (MW of target protein)
-