CELF5 Antikörper (Middle Region)

Produktnummer ABIN633506

Der Kaninchen Polyklonal Anti-CELF5-Antikörper wurde für WB validiert. Er ist geeignet, CELF5 in Proben von Human zu detektieren.

Kurzübersicht für CELF5 Antikörper (Middle Region) (ABIN633506)

Target: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CELF5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BRUNOL5 antibody was raised against the middle region of BRUNOL5

Aufreinigung: Affinity purified

Immunogen: BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRUNOL5 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF5

Target: CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))

Andere Bezeichnung: BRUNOL5

Hintergrund: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

Molekulargewicht: 52 kDa (MW of target protein)