KLHL23 Antikörper

Produktnummer ABIN633495

Produktdetails anti-KLHL23 Antikörper

Target: KLHL23 (Kelch-Like 23 (KLHL23))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL23 Blocking Peptide, catalog no. 33R-9387, is also available for use as a blocking control in assays to test for specificity of this KLHL23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL23

Target: KLHL23 (Kelch-Like 23 (KLHL23))

Andere Bezeichnung: KLHL23 (KLHL23 Produkte)

Synonyme: DITHP antikoerper, C130068N17Rik antikoerper, RGD1307166 antikoerper, Klhl23 antikoerper, kelch like family member 23 antikoerper, kelch-like 23 antikoerper, kelch-like family member 23 antikoerper, kelch-like protein 23 antikoerper, kelch-like 23 (Drosophila) antikoerper, KLHL23 antikoerper, Klhl23 antikoerper, LOC488392 antikoerper, LOC100731969 antikoerper

Hintergrund: This protein mediates protein binding.

Molekulargewicht: 64 kDa (MW of target protein)