IGF2BP1 Antikörper (N-Term)

Produktnummer ABIN633481

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IGF2BP1 in WB. Er zeigt eine Reaktivität gegenüber Human und Ratte.

Kurzübersicht für IGF2BP1 Antikörper (N-Term) (ABIN633481)

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGF2BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IGF2BP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: IGF2 BP1 antibody was raised against the N terminal of IGF2 P1

Aufreinigung: Affinity purified

Immunogen: IGF2 BP1 antibody was raised using the N terminal of IGF2 P1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGF2BP1 Blocking Peptide, (ABIN5614153), is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGF2BP1

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Andere Bezeichnung: IGF2BP1

Hintergrund: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Molekulargewicht: 63 kDa (MW of target protein)