EIF4A2 Antikörper (N-Term)

Produktnummer ABIN633476

Produktdetails anti-EIF4A2 Antikörper

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 A2 antibody was raised against the N terminal of EIF4 2

Aufreinigung: Affinity purified

Immunogen: EIF4 A2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4A2 Blocking Peptide, catalog no. 33R-6430, is also available for use as a blocking control in assays to test for specificity of this EIF4A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4A2

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Andere Bezeichnung: EIF4A2 (EIF4A2 Produkte)

Synonyme: BM-010 antikoerper, DDX2B antikoerper, EIF4A antikoerper, EIF4F antikoerper, eIF-4A-II antikoerper, eIF4A-II antikoerper, 4833432N07Rik antikoerper, Ddx2b antikoerper, Eif4 antikoerper, ddx2b antikoerper, eif4aii antikoerper, eif4f antikoerper, xeif4aii antikoerper, EIF4A2 antikoerper, EIF4AII antikoerper, wu:fd50g11 antikoerper, zgc:63783 antikoerper, eukaryotic translation initiation factor 4A2 antikoerper, eukaryotic translation initiation factor 4A2 L homeolog antikoerper, microRNA 1248 antikoerper, eukaryotic translation initiation factor 4A, isoform 2 antikoerper, Eif4a2 antikoerper, EIF4A2 antikoerper, eif4a2.L antikoerper, eif4a2 antikoerper, MIR1248 antikoerper

Hintergrund: EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Molekulargewicht: 45 kDa (MW of target protein)