EIF4G2 Antikörper (C-Term)
-
- Target Alle EIF4G2 Antikörper anzeigen
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF4G2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF4 G2 antibody was raised against the C terminal of EIF4 2
- Aufreinigung
- Affinity purified
- Immunogen
- EIF4 G2 antibody was raised using the C terminal of EIF4 2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
- Top Product
- Discover our top product EIF4G2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF4G2 Blocking Peptide, catalog no. 33R-4390, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
- Andere Bezeichnung
- EIF4G2 (EIF4G2 Produkte)
- Hintergrund
- Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.
- Molekulargewicht
- 39 kDa (MW of target protein)
-