EIF4G2 Antikörper (C-Term)

Produktnummer ABIN633475

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EIF4G2 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für EIF4G2 Antikörper (C-Term) (ABIN633475)

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4G2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF4G2 Antikörper

Bindungsspezifität: C-Term

Spezifität: EIF4 G2 antibody was raised against the C terminal of EIF4 2

Aufreinigung: Affinity purified

Immunogen: EIF4 G2 antibody was raised using the C terminal of EIF4 2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4G2 Blocking Peptide, (ABIN939776), is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4G2

Target: EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))

Andere Bezeichnung: EIF4G2

Hintergrund: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.

Molekulargewicht: 39 kDa (MW of target protein)