DAZ4 Antikörper (Middle Region)

Produktnummer ABIN633467

Der Kaninchen-Polyklonal Anti-DAZ4-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von DAZ4 in Proben aus Human. }

Kurzübersicht für DAZ4 Antikörper (Middle Region) (ABIN633467)

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZ4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DAZ4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DAZ4 antibody was raised against the middle region of DAZ4

Aufreinigung: Affinity purified

Immunogen: DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZ4 Blocking Peptide, (ABIN939562), is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZ4

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Andere Bezeichnung: DAZ4

Hintergrund: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Molekulargewicht: 44 kDa (MW of target protein)