EXOSC6 Antikörper (N-Term)

Produktnummer ABIN633462

Produktdetails anti-EXOSC6 Antikörper

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EXOSC6 antibody was raised against the N terminal of EXOSC6

Aufreinigung: Affinity purified

Immunogen: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC6 Blocking Peptide, catalog no. 33R-5560, is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC6

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Andere Bezeichnung: EXOSC6 (EXOSC6 Produkte)

Synonyme: exosc6 antikoerper, RAR-gamma antikoerper, id:ibd1130 antikoerper, wu:fe17d05 antikoerper, zgc:110071 antikoerper, EAP4 antikoerper, MTR3 antikoerper, Mtr3p antikoerper, hMtr3p antikoerper, p11 antikoerper, 2610510N21Rik antikoerper, C76919 antikoerper, Mtr3 antikoerper, exosome component 6 antikoerper, EXOSC6 antikoerper, exosc6 antikoerper, CpipJ_CPIJ018071 antikoerper, Exosc6 antikoerper

Hintergrund: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response