EXOSC6 Antikörper (N-Term)

Produktnummer ABIN633462

Dieses Anti-EXOSC6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EXOSC6 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für EXOSC6 Antikörper (N-Term) (ABIN633462)

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOSC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EXOSC6 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOSC6 antibody was raised against the N terminal of EXOSC6

Aufreinigung: Affinity purified

Immunogen: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOSC6 Blocking Peptide, (ABIN5613436), is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOSC6

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Andere Bezeichnung: EXOSC6

Hintergrund: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response