FAM156A Antikörper (N-Term)

Produktnummer ABIN633460

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch FAM156A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FAM156A Antikörper (N-Term) (ABIN633460)

Target: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM156A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM156A Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM156 A antibody was raised against the N terminal of FAM156

Aufreinigung: Affinity purified

Immunogen: FAM156 A antibody was raised using the N terminal of FAM156 corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM156A Blocking Peptide, (ABIN937492), is also available for use as a blocking control in assays to test for specificity of this FAM156A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM150 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM156A

Target: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Andere Bezeichnung: FAM156A

Hintergrund: The function of FAM156A protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 24 kDa (MW of target protein)