CELF2 Antikörper (N-Term)
-
- Target Alle CELF2 Antikörper anzeigen
- CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CELF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CUGBP2 antibody was raised against the N terminal of CUGBP2
- Aufreinigung
- Affinity purified
- Immunogen
- CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
- Top Product
- Discover our top product CELF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CUGBP2 Blocking Peptide, catalog no. 33R-9274, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))
- Andere Bezeichnung
- CUGBP2 (CELF2 Produkte)
- Synonyme
- CUGBP2 antikoerper, BRUNOL3 antikoerper, ETR-3 antikoerper, ETR3 antikoerper, NAPOR antikoerper, B230218O03 antikoerper, B230345P09Rik antikoerper, C88023 antikoerper, CELF-2 antikoerper, CUG-BP2 antikoerper, Cugbp2 antikoerper, D230046B21Rik antikoerper, Etr-3 antikoerper, Napor antikoerper, Napor-2 antikoerper, mETR-3 antikoerper, cb906 antikoerper, cugbp2 antikoerper, fj87b07 antikoerper, wu:fj87b07 antikoerper, brunol3 antikoerper, celf2 antikoerper, cugbp2-a antikoerper, etr3 antikoerper, napor antikoerper, Brunol3 antikoerper, Etr3 antikoerper, CUGBP Elav-like family member 2 antikoerper, CUGBP, Elav-like family member 2 antikoerper, cugbp, Elav-like family member 2 antikoerper, CUGBP, Elav-like family member 2 L homeolog antikoerper, CELF2 antikoerper, Celf2 antikoerper, celf2 antikoerper, celf2.L antikoerper
- Hintergrund
- CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-