CELF2 Antikörper (N-Term)

Produktnummer ABIN633459

Produktdetails anti-CELF2 Antikörper

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CUGBP2 antibody was raised against the N terminal of CUGBP2

Aufreinigung: Affinity purified

Immunogen: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUGBP2 Blocking Peptide, catalog no. 33R-9274, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF2

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Andere Bezeichnung: CUGBP2 (CELF2 Produkte)

Synonyme: CUGBP2 antikoerper, BRUNOL3 antikoerper, ETR-3 antikoerper, ETR3 antikoerper, NAPOR antikoerper, B230218O03 antikoerper, B230345P09Rik antikoerper, C88023 antikoerper, CELF-2 antikoerper, CUG-BP2 antikoerper, Cugbp2 antikoerper, D230046B21Rik antikoerper, Etr-3 antikoerper, Napor antikoerper, Napor-2 antikoerper, mETR-3 antikoerper, cb906 antikoerper, cugbp2 antikoerper, fj87b07 antikoerper, wu:fj87b07 antikoerper, brunol3 antikoerper, celf2 antikoerper, cugbp2-a antikoerper, etr3 antikoerper, napor antikoerper, Brunol3 antikoerper, Etr3 antikoerper, CUGBP Elav-like family member 2 antikoerper, CUGBP, Elav-like family member 2 antikoerper, cugbp, Elav-like family member 2 antikoerper, CUGBP, Elav-like family member 2 L homeolog antikoerper, CELF2 antikoerper, Celf2 antikoerper, celf2 antikoerper, celf2.L antikoerper

Hintergrund: CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization