CELF2 Antikörper (N-Term)

Produktnummer ABIN633459

Dieses Anti-CELF2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CELF2 in WB. Geeignet für Human.

Kurzübersicht für CELF2 Antikörper (N-Term) (ABIN633459)

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CELF2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CUGBP2 antibody was raised against the N terminal of CUGBP2

Aufreinigung: Affinity purified

Immunogen: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUGBP2 Blocking Peptide, (ABIN5613033), is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF2

Target: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Andere Bezeichnung: CUGBP2

Hintergrund: CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization